PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID MLOC_64240.2
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Pooideae; Triticodae; Triticeae; Hordeinae; Hordeum
Family NAC
Protein Properties Length: 304aa    MW: 33311.9 Da    PI: 9.4534
Description NAC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
MLOC_64240.2genomeIBSCView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM168.42.4e-52131421129
           NAM   1 lppGfrFhPtdeelvveyLkkkvegkk.leleev.ikevdiykvePwdLpkkvkaeekewyfFskrdkkyatgkrknratksgyWkatgkdkevlsk 95 
                   lppGfrFhP+d+el+++yL++kv+gk  ++  +  + +vd++kvePwdLp +++ + kewyf+s +d+kyatg+r+nrat sgyWkatgkd+ v + 
  MLOC_64240.2  13 LPPGFRFHPRDDELICDYLAPKVTGKVgFSGRRPpMVDVDLNKVEPWDLPVTASVGGKEWYFYSLKDRKYATGQRTNRATVSGYWKATGKDRVVAR- 108
                   79************************986665656***************8888899***********************************9999. PP

           NAM  96 kgelvglkktLvfykgrapkgektdWvmheyrle 129
                   +g+lvg++ktLvfy+grapkg+kt+Wvmheyrle
  MLOC_64240.2 109 RGALVGMRKTLVFYQGRAPKGRKTEWVMHEYRLE 142
                   999*****************************85 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019411.7E-582161IPR003441NAC domain
PROSITE profilePS5100555.10213161IPR003441NAC domain
PfamPF023651.2E-2614141IPR003441NAC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 304 aa     Download sequence    Send to blast
MSMSFLSMVE TELPPGFRFH PRDDELICDY LAPKVTGKVG FSGRRPPMVD VDLNKVEPWD  60
LPVTASVGGK EWYFYSLKDR KYATGQRTNR ATVSGYWKAT GKDRVVARRG ALVGMRKTLV  120
FYQGRAPKGR KTEWVMHEYR LEGAHEQASK EDWVLCRVIC KKKSGVGATP RPRNLTNIVH  180
GTSTDTSSPP LPPLMDTTLA QLHATMNTSA AATAALEQVP CFSSFSNNSA SNSSYLPMVT  240
GNGNGMSYLD HGLPDFGSYL DPSTNCDKKV LKAVLSQLSS MGGEVVPSMS AQMAAAVSST  300
WNHF
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
3ulx_A3e-49916211169Stress-induced transcription factor NAC1
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAM5008550.0AM500855.1 Hordeum vulgare subsp. vulgare mRNA for NAC transcription factor (nac1 gene).
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_003577546.10.0PREDICTED: NAC domain-containing protein 21/22-like isoform X2
RefseqXP_010237041.10.0PREDICTED: NAC domain-containing protein 21/22-like isoform X1
SwissprotQ84TE64e-89NAC22_ARATH; NAC domain-containing protein 21/22
TrEMBLA4HRC20.0A4HRC2_HORVD; NAC transcription factor
STRINGMLOC_64240.20.0(Hordeum vulgare)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP100223144
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G56010.25e-78NAC domain containing protein 1